Influência dos moduladores genéticos nos níveis de hemoglobina fetal na anemia falciforme: revisão literária

Sickle cell anemia is a disease of genetic origin in which the individual has chronic hemolysis and pain crises resulting from vaso occlusion. It is caused by a failure in the synthesis of the molecular structure of hemoglobin, more specifically in the 6th codon of the beta-globin gene (HBB) on chro...

ver descrição completa

Na minha lista:
Detalhes bibliográficos
Autor principal: Gorgônio, Júlia Costa
Outros Autores: Rebecchi, Ivanise Marina Moretti
Formato: bachelorThesis
Idioma:pt_BR
Publicado em: Universidade Federal do Rio Grande do Norte
Assuntos:
KLF
BCL11A
HBS1L-MYB
Genes
Anemia Falciforme
Sickle Cell Anemia
Endereço do item:https://repositorio.ufrn.br/handle/123456789/45899
Tags: Adicionar Tag
Sem tags, seja o primeiro a adicionar uma tag!
id ri-123456789-45899
record_format dspace
spelling ri-123456789-458992022-02-09T13:59:42Z Influência dos moduladores genéticos nos níveis de hemoglobina fetal na anemia falciforme: revisão literária Influence of gene modulators on fetal hemoglobin levels in sickle cell anemia: literary review Gorgônio, Júlia Costa Rebecchi, Ivanise Marina Moretti http://lattes.cnpq.br/8993923433910296 Domingos, Igor de Farias Fernandes, Thales Allyrio Araújo de Medeiros Arcanjo, Gabriela da Silva KLF BCL11A HBS1L-MYB Genes Anemia Falciforme Sickle Cell Anemia Sickle cell anemia is a disease of genetic origin in which the individual has chronic hemolysis and pain crises resulting from vaso occlusion. It is caused by a failure in the synthesis of the molecular structure of hemoglobin, more specifically in the 6th codon of the beta-globin gene (HBB) on chromosome 11, with the exchange of the glutamic acid amino acid for valine. In addition, alterations in genes that are not related to synthesis of globin chains, such as genes related to fetal hemoglobin synthesis, can modulate the clinical picture of patients and, thus, determine whether the individual will have milder or more severe forms of the disease. The aim of this study was to carry out a literary and systematic review of the influence of KLF genes in modulating the clinical picture of patients with sickle cell anemia. The selected literature was taken from scientific databases such as Google Academic, Scielo, Pubmed and Mayo Clinic Proceedings in the period between 2001 and 2021, with some exceptions. The evaluation of the works used in the development of this systematic review revealed the importance of the KLF, BCL11A and HBS1L-MYB genes in the regulation of fetal hemoglobin and the clinical picture of patients with sickle cell anemia. This fact reinforces the real need for an in-depth study of the genes involved for better care and more adequate therapeutic management of these patients, ensuring an increase in the quality of life of patients with sickle cell anemia. A anemia falciforme é uma doença de origem genética em que o indivíduo apresenta hemólise crônica e crises de dor decorrentes da vaso-oclusão. É causada por uma falha na síntese da estrutura molecular da hemoglobina, mais especificamente no 6° códon do gene da beta-globina (HBB) no cromossomo 11, havendo a troca do aminoácido ácido glutâmico pela valina. Além disso, alterações em genes que não estão relacionados à síntese das cadeias globínicas, como genes relacionados à síntese de hemoglobina fetal, podem modular o quadro clínico dos pacientes e, assim, determinar se o indivíduo terá formas mais brandas ou mais severas da doença. O objetivo deste estudo foi realizar uma revisão literária a respeito da influência dos genes KLF na modulação do quadro clínico de pacientes portadores da anemia falciforme. A literatura selecionada foi retirada de bases científicas como a Google Acadêmico, Scielo, Pubmed e Mayo Clinic Proceedings no período entre os anos de 2001 e 2021, com algumas exceções. A avaliação dos trabalhos utilizados no desenvolvimento desta revisão literária revelou a importância dos genes KLF, BCL11A e HBS1L-MYB na regulação da hemoglobina fetal e do quadro clínico de pacientes com anemia falciforme. Esse fato reforça a real necessidade do estudo aprofundado dos genes envolvidos para melhor cuidado e manejo terapêutico mais adequado desses pacientes, garantindo uma elevação na qualidade de vida dos portadores da anemia falciforme. 2022-02-09T13:59:42Z 2022-02-09T13:59:42Z 2022-01-27 bachelorThesis GORGÔNIO, Júlia Costa. Influência dos moduladores genéticos nos níveis de hemoglobina fetal na anemia falciforme: revisão literária. 2022. 54f. Trabalho de Conclusão de Curso (Graduação em Farmácia), Departamento de Farmácia, Universidade Federal do Rio Grande do Norte, Centro de Ciências da Saúde, Natal, 2022. https://repositorio.ufrn.br/handle/123456789/45899 pt_BR application/pdf Universidade Federal do Rio Grande do Norte Brasil UFRN CENTRO DE CIÊNCIAS DA SAÚDE DEPARTAMENTO DE FARMÁCIA
institution Repositório Institucional
collection RI - UFRN
language pt_BR
topic KLF
BCL11A
HBS1L-MYB
Genes
Anemia Falciforme
Sickle Cell Anemia
spellingShingle KLF
BCL11A
HBS1L-MYB
Genes
Anemia Falciforme
Sickle Cell Anemia
Gorgônio, Júlia Costa
Influência dos moduladores genéticos nos níveis de hemoglobina fetal na anemia falciforme: revisão literária
description Sickle cell anemia is a disease of genetic origin in which the individual has chronic hemolysis and pain crises resulting from vaso occlusion. It is caused by a failure in the synthesis of the molecular structure of hemoglobin, more specifically in the 6th codon of the beta-globin gene (HBB) on chromosome 11, with the exchange of the glutamic acid amino acid for valine. In addition, alterations in genes that are not related to synthesis of globin chains, such as genes related to fetal hemoglobin synthesis, can modulate the clinical picture of patients and, thus, determine whether the individual will have milder or more severe forms of the disease. The aim of this study was to carry out a literary and systematic review of the influence of KLF genes in modulating the clinical picture of patients with sickle cell anemia. The selected literature was taken from scientific databases such as Google Academic, Scielo, Pubmed and Mayo Clinic Proceedings in the period between 2001 and 2021, with some exceptions. The evaluation of the works used in the development of this systematic review revealed the importance of the KLF, BCL11A and HBS1L-MYB genes in the regulation of fetal hemoglobin and the clinical picture of patients with sickle cell anemia. This fact reinforces the real need for an in-depth study of the genes involved for better care and more adequate therapeutic management of these patients, ensuring an increase in the quality of life of patients with sickle cell anemia.
author2 Rebecchi, Ivanise Marina Moretti
author_facet Rebecchi, Ivanise Marina Moretti
Gorgônio, Júlia Costa
format bachelorThesis
author Gorgônio, Júlia Costa
author_sort Gorgônio, Júlia Costa
title Influência dos moduladores genéticos nos níveis de hemoglobina fetal na anemia falciforme: revisão literária
title_short Influência dos moduladores genéticos nos níveis de hemoglobina fetal na anemia falciforme: revisão literária
title_full Influência dos moduladores genéticos nos níveis de hemoglobina fetal na anemia falciforme: revisão literária
title_fullStr Influência dos moduladores genéticos nos níveis de hemoglobina fetal na anemia falciforme: revisão literária
title_full_unstemmed Influência dos moduladores genéticos nos níveis de hemoglobina fetal na anemia falciforme: revisão literária
title_sort influência dos moduladores genéticos nos níveis de hemoglobina fetal na anemia falciforme: revisão literária
publisher Universidade Federal do Rio Grande do Norte
publishDate 2022
url https://repositorio.ufrn.br/handle/123456789/45899
work_keys_str_mv AT gorgoniojuliacosta influenciadosmoduladoresgeneticosnosniveisdehemoglobinafetalnaanemiafalciformerevisaoliteraria
AT gorgoniojuliacosta influenceofgenemodulatorsonfetalhemoglobinlevelsinsicklecellanemialiteraryreview
_version_ 1773964170317791232

Registros relacionados